From rob.townley at gmail.com  Thu Mar  1 06:22:35 2007
From: rob.townley at gmail.com (Rob Townley)
Date: Thu, 1 Mar 2007 08:22:35 -0600
Subject: [Omaha.pm] Perl, Python, Ruby or PHP ...
In-Reply-To: <d07515e20702281218j5a6ff8cek67b0baae4a1fbbfd@mail.gmail.com>
References: <6cb6eebc0702241208o31a3a2dcvac27cc4f2e11a492@mail.gmail.com>
	<200702281325.23179.dthacker9@cox.net>
	<d07515e20702281218j5a6ff8cek67b0baae4a1fbbfd@mail.gmail.com>
Message-ID: <7e84ed60703010622v40c550afuab2186b84b8e6a74@mail.gmail.com>

On 2/28/07, Jake Churchill <reynacho at gmail.com> wrote:
> Having also taken Bob's Programming on the Internet course, I would like to
> post my vote for the continued use of Perl.  I think once you learn Perl,
> all other scripting languages are pretty easy to learn.  Similar to how
> after learning C/C++, Java is a breeze.
>
> -Jake

ditto

From jay at jays.net  Fri Mar  2 14:57:19 2007
From: jay at jays.net (Jay Hannah)
Date: Fri, 2 Mar 2007 16:57:19 -0600 (CST)
Subject: [Omaha.pm] Split Apache conf file into separate files
Message-ID: <Pine.LNX.4.64.0703021656001.2939@ferret.jays.net>


By request today...

j


#!/usr/bin/perl

my $read_this_file = "./vhosts.conf";

# Read an Apache conf file w/ multiple VirtualHost directives and
# split each VirtualHost into a separate file.
#
# This'd be cleaner w/ an XML parser (*cough* XML::Twig), but I don't
# know if the user has any XML libraries installed.
#
# 2007-03-02 | Omaha Perl Mongers | http://omaha.pm.org

$/ = '</VirtualHost>';
open (IN, $read_this_file) or die "Unable to open $read_this_file";
while (<IN>) {
    s/.*(<VirtualHost)/$1/s;
    my ($server_name) = /ServerName (.*)/;
    next unless $server_name;
    open (OUT, ">$server_name.conf") or die "Unable to write to $server_name.conf";
    print OUT $_;
    close OUT;
}
close IN;



From georgen at neillnet.com  Fri Mar  2 14:49:14 2007
From: georgen at neillnet.com (George Neill)
Date: Fri, 02 Mar 2007 16:49:14 -0600
Subject: [Omaha.pm] Split Apache conf file into separate files
In-Reply-To: <Pine.LNX.4.64.0703021656001.2939@ferret.jays.net>
References: <Pine.LNX.4.64.0703021656001.2939@ferret.jays.net>
Message-ID: <20070302164914.u2cbnuyf4wo408ok@www.neillnet.com>

Jay,

If you didn't already know ... apache ships with a log splitter perl  
script. Might be interesting to compare with what you have.

http://httpd.apache.org/docs/2.2/programs/other.html

Later,
George.



Quoting Jay Hannah <jay at jays.net>:

>
> By request today...
>
> j
>
>
> #!/usr/bin/perl
>
> my $read_this_file = "./vhosts.conf";
>
> # Read an Apache conf file w/ multiple VirtualHost directives and
> # split each VirtualHost into a separate file.
> #
> # This'd be cleaner w/ an XML parser (*cough* XML::Twig), but I don't
> # know if the user has any XML libraries installed.
> #
> # 2007-03-02 | Omaha Perl Mongers | http://omaha.pm.org
>
> $/ = '</VirtualHost>';
> open (IN, $read_this_file) or die "Unable to open $read_this_file";
> while (<IN>) {
>     s/.*(<VirtualHost)/$1/s;
>     my ($server_name) = /ServerName (.*)/;
>     next unless $server_name;
>     open (OUT, ">$server_name.conf") or die "Unable to write to   
> $server_name.conf";
>     print OUT $_;
>     close OUT;
> }
> close IN;
>
>
> _______________________________________________
> Omaha-pm mailing list
> Omaha-pm at pm.org
> http://mail.pm.org/mailman/listinfo/omaha-pm
>
> !DSPAM:45e8a296243457785049143!
>
>



From jay at jays.net  Fri Mar  2 19:18:28 2007
From: jay at jays.net (Jay Hannah)
Date: Fri, 2 Mar 2007 21:18:28 -0600
Subject: [Omaha.pm] Perl, Python, Ruby or PHP ...
In-Reply-To: <16F8D15756891C4EA961565331A3B350066CDFB1@JDHEXC01.heiskell.com>
References: <16F8D15756891C4EA961565331A3B350066CDFB1@JDHEXC01.heiskell.com>
Message-ID: <1a663c338eec72b5f67ef040fbb2879f@jays.net>

On Feb 28, 2007, at 2:27 PM, Thompson, Kenn wrote:
> Here's food for thought... Given it's an "Internet" programming 
> course, with no previous experience needed (meaning it would be 
> unlikely that the student would know/understand concepts such as OO, 
> typecasting/etc), wouldn't it be better to start the series with a 
> crash course in JavaScript, then follow up with a strong language like 
> Perl?

I've only ever talked to one person that enjoys programming JavaScript. 
The general sentiment (even among Java programmers) I've heard is 
dislike to hatred of JavaScript. I've often heard it has no relation to 
Java and "not a real language"...?

$0.02,

j


From jay at jays.net  Fri Mar  2 19:21:03 2007
From: jay at jays.net (Jay Hannah)
Date: Fri, 2 Mar 2007 21:21:03 -0600
Subject: [Omaha.pm] Split Apache conf file into separate files
In-Reply-To: <20070302164914.u2cbnuyf4wo408ok@www.neillnet.com>
References: <Pine.LNX.4.64.0703021656001.2939@ferret.jays.net>
	<20070302164914.u2cbnuyf4wo408ok@www.neillnet.com>
Message-ID: <37a0667a9cfaf7c1d194ee15fdc3af98@jays.net>

On Mar 2, 2007, at 4:49 PM, George Neill wrote:
> If you didn't already know ... apache ships with a log splitter perl
> script. Might be interesting to compare with what you have.
>
> http://httpd.apache.org/docs/2.2/programs/other.html

Thanks! My program, however, was a configuration file splitter not a 
log splitter. :)

j


From KThompson at heiskell.com  Sat Mar  3 07:32:00 2007
From: KThompson at heiskell.com (Thompson, Kenn)
Date: Sat, 3 Mar 2007 07:32:00 -0800 
Subject: [Omaha.pm] Perl, Python, Ruby or PHP ...
Message-ID: <16F8D15756891C4EA961565331A3B35006758F96@JDHEXC01.heiskell.com>

> Here's food for thought... Given it's an "Internet" programming 
> course, with no previous experience needed (meaning it would be 
> unlikely that the student would know/understand concepts such as OO, 
> typecasting/etc), wouldn't it be better to start the series with a 
> crash course in JavaScript, then follow up with a strong language like 
> Perl?

-I've only ever talked to one person that enjoys programming JavaScript. 
-The general sentiment (even among Java programmers) I've heard is 
-dislike to hatred of JavaScript. I've often heard it has no relation to 
-Java and "not a real language"...?

I would have to agree that it's not exactly pleasant to code in, but given
the venue it's probably one of the few languages that is used for web based
apps that's mostly available in all browsers. I'd even go so far as to say
that if you're writing for the web it should be a requirement to not only to
be somewhat proficient in Javascript but also in the most popular browser
DOMs.

Javascript does have most of the programming constructs available
(IF-THEN-ELSE, CASE, etc), and can be used on most platforms for learning
purposes, even without a server component. I wouldn't use it for production
level code unless absolutely necessary, but even big business is still tied
to it because of the browser. Also, as long as AJAX-like/Web 2.0 is in play,
it'd be tough to not be exposed at some point.

< side note... I kind of like Javascript, but I'm a masochist ;) > 



From jay at jays.net  Sat Mar  3 08:21:57 2007
From: jay at jays.net (Jay Hannah)
Date: Sat, 3 Mar 2007 10:21:57 -0600
Subject: [Omaha.pm] Perl, Python, Ruby or PHP ...
In-Reply-To: <16F8D15756891C4EA961565331A3B35006758F96@JDHEXC01.heiskell.com>
References: <16F8D15756891C4EA961565331A3B35006758F96@JDHEXC01.heiskell.com>
Message-ID: <28d936064c25afcdd9d0d01c782dd16d@jays.net>

On Mar 3, 2007, at 9:32 AM, Thompson, Kenn wrote:
> I wouldn't use it for production level code unless absolutely 
> necessary, but even big business is still tied to it because of the 
> browser. Also, as long as AJAX-like/Web 2.0 is in play, it'd be tough 
> to not be exposed at some point.
>
> < side note... I kind of like Javascript, but I'm a masochist ;) >

Agreed. It's certainly ubiquitously unavoidable for web warriors. I 
just don't know that I'd spend a lot of time trying to teach it if 
students might not yet be proficient coders in any language. Any other 
language first...

Another trend I've noticed is people trying like hell to spare others 
the pain of Javascript by releasing toolkits that hide the glitch-fest:

Google Web Toolkit (GWT)
    http://code.google.com/webtoolkit/
    "Writing dynamic web applications today is a tedious and error-prone 
process; you spend 90% of your time working around subtle 
incompatibilities between web browsers and platforms, and JavaScript's 
lack of modularity makes sharing, testing, and reusing AJAX components 
difficult and fragile. GWT lets you avoid many of these headaches..."

No point making coding neophytes miserable. Not at least until they're 
getting paid to suffer. :)

But what do I know? While I consider myself an e-commerce developer 
I've never claimed to be a browser-side pretty stuff ninja.

j


From georgen at neillnet.com  Sat Mar  3 18:36:57 2007
From: georgen at neillnet.com (George Neill)
Date: Sat, 03 Mar 2007 20:36:57 -0600
Subject: [Omaha.pm] Split Apache conf file into separate files
In-Reply-To: <37a0667a9cfaf7c1d194ee15fdc3af98@jays.net>
References: <Pine.LNX.4.64.0703021656001.2939@ferret.jays.net>
	<20070302164914.u2cbnuyf4wo408ok@www.neillnet.com>
	<37a0667a9cfaf7c1d194ee15fdc3af98@jays.net>
Message-ID: <20070303203657.mhumdlt2as48ooko@www.neillnet.com>

Quoting Jay Hannah <jay at jays.net>:
> Thanks! My program, however, was a configuration file splitter not a
> log splitter. :)

Man ... sorry, apparently I can't read.  I'd post the awk script I  
wrote which does the same thing ... but probably not the right place  
for that :)

Later,
George.


From jay at jays.net  Sun Mar  4 07:13:13 2007
From: jay at jays.net (Jay Hannah)
Date: Sun, 4 Mar 2007 09:13:13 -0600
Subject: [Omaha.pm] Split Apache conf file into separate files
In-Reply-To: <20070303203657.mhumdlt2as48ooko@www.neillnet.com>
References: <Pine.LNX.4.64.0703021656001.2939@ferret.jays.net>
	<20070302164914.u2cbnuyf4wo408ok@www.neillnet.com>
	<37a0667a9cfaf7c1d194ee15fdc3af98@jays.net>
	<20070303203657.mhumdlt2as48ooko@www.neillnet.com>
Message-ID: <0D619C6A-1916-43E4-B976-266E353826FC@jays.net>

On Mar 3, 2007, at 8:36 PM, George Neill wrote:
> Man ... sorry, apparently I can't read.  I'd post the awk script I
> wrote which does the same thing ... but probably not the right place
> for that :)

No worries. Have you found yourself needing to split Apache logs before?

I assume my friend's Apache conf grew and grew over the years until  
he couldn't stand it any more and that's why he wanted that script  
from me... -shrug-

j



From jay at jays.net  Sun Mar  4 07:24:23 2007
From: jay at jays.net (Jay Hannah)
Date: Sun, 4 Mar 2007 09:24:23 -0600
Subject: [Omaha.pm] Meeting reminder: Tue, 13 Mar 2007 @ 7pm!
Message-ID: <AAB4ACF3-D1FF-4641-99C9-944B49F88C20@jays.net>

[Weird. I remembered to send this email. So I guess this month isn't  
a secret meeting. -grin-]


http://omaha.pm.org/
Tue, 13 Mar 2007 @ 7pm!

Topic suggestions and guest speakers welcome.


Some things I've been mucking with lately:

- seqlab.net: BioPerl: Kiran and I have been QA'ing GenBank sequence  
data w/ various open reading frames. Given a dataset like this:

70987046 found in BC-I.Organism2.seq
.seq ORF 0: MNQKNPKDTQNFITSKKHVKEILNHTNISKQDNVIEIGSGKGHFTX
.seq ORF 1: *TRKTLKTRKILLLLKSM*KKY*ITRISVNKTT**KSDQEKDILP
.seq ORF 2: EPEKP*RHAKFYYF*KACKRNIESHEYQ*TRQRNRNRIRKRTFYQ
GenBank:    MNQKNPKDTQNFITSKKHVKEILNHTNISKQDNVIEIGSGKGHFT

Can you detect that that ORF 0 is "close enough" to GenBank?  :)

- DBI::Profile - Profile your DBI database interaction by writing 0  
lines of additional code.  :)

- Nobody is interested in hold a Perl Quiz Night?

http://mail.pm.org/pipermail/omaha-pm/2007-February/001326.html

- Nobody else uses Perl? You fibbers. :)

http://omaha.pm.org/kwiki/index.cgi?LocalOrganizationsWhoUsePerl



Our meetings are sponsored by Paragon IT Professionals. Thanks for  
the pizza Jimmy Smith!


See ya there!

j



From georgen at neillnet.com  Tue Mar  6 10:39:55 2007
From: georgen at neillnet.com (George Neill)
Date: Tue, 06 Mar 2007 12:39:55 -0600
Subject: [Omaha.pm] Split Apache conf file into separate files
In-Reply-To: <0D619C6A-1916-43E4-B976-266E353826FC@jays.net>
References: <Pine.LNX.4.64.0703021656001.2939@ferret.jays.net>
	<20070302164914.u2cbnuyf4wo408ok@www.neillnet.com>
	<37a0667a9cfaf7c1d194ee15fdc3af98@jays.net>
	<20070303203657.mhumdlt2as48ooko@www.neillnet.com>
	<0D619C6A-1916-43E4-B976-266E353826FC@jays.net>
Message-ID: <20070306123955.wp1a2r5008484k00@www.neillnet.com>

> No worries. Have you found yourself needing to split Apache logs before?

Yes, apache -- mod_vhost_alias only captures to one log file.

Later,
George.


From jay at jays.net  Tue Mar  6 21:31:51 2007
From: jay at jays.net (Jay Hannah)
Date: Tue, 6 Mar 2007 23:31:51 -0600
Subject: [Omaha.pm] Split Apache conf file into separate files
In-Reply-To: <20070306125125.tx2hao4328s4g4k8@www.neillnet.com>
References: <Pine.LNX.4.64.0703021656001.2939@ferret.jays.net>
	<20070302164914.u2cbnuyf4wo408ok@www.neillnet.com>
	<37a0667a9cfaf7c1d194ee15fdc3af98@jays.net>
	<20070303203657.mhumdlt2as48ooko@www.neillnet.com>
	<0D619C6A-1916-43E4-B976-266E353826FC@jays.net>
	<20070306125125.tx2hao4328s4g4k8@www.neillnet.com>
Message-ID: <622596e125b4063c33c7443cb2c1e7f2@jays.net>

On Mar 6, 2007, at 12:51 PM, George Neill wrote:
> Here's that quick little awk script I wrote to pull virtuals from 
> apache conf, probably not the best looking script but it has worked 
> out well for me.
>
> [gneill at blackfoot ~]$ cat parse.awk
> /<VirtualHost / { save = "" }
> /ServerName/    { host = $2 }
>
> { save = sprintf("%s%s\n", save, $0); }
>
> /<\/VirtualHost>/ { print save > "tmp/"host".conf"; }
>
>
> [gneill at blackfoot ~]$ awk -f parse.awk < some_apache_conf_file

Thanks!

I think it's perfectly legit to post things like this to the list for 
the sake of comparison to Perl. :)

j



From dthacker9 at cox.net  Fri Mar  9 05:20:27 2007
From: dthacker9 at cox.net (Dave Thacker)
Date: Fri, 9 Mar 2007 07:20:27 -0600
Subject: [Omaha.pm] Bleadperl?
Message-ID: <200703090720.27896.dthacker9@cox.net>

What is Bleadperl?  GTFI gets me many diary entries, but no actual project. 
This popped up on the TT list in a discussion about TT and OSX....

Dave

From andy at petdance.com  Fri Mar  9 05:51:23 2007
From: andy at petdance.com (Andy Lester)
Date: Fri, 9 Mar 2007 07:51:23 -0600
Subject: [Omaha.pm] Bleadperl
In-Reply-To: <200703090720.27896.dthacker9@cox.net>
References: <200703090720.27896.dthacker9@cox.net>
Message-ID: <9C2A0C97-118E-4354-892F-4ADB7638AFC7@petdance.com>


On Mar 9, 2007, at 7:20 AM, Dave Thacker wrote:

> What is Bleadperl?  GTFI gets me many diary entries, but no actual  
> project.
> This popped up on the TT list in a discussion about TT and OSX....

It's a development version that the perl5-porters work on.

xoxo,
Andy

--
Andy Lester => andy at petdance.com => www.petdance.com => AIM:petdance





From jhannah at omnihotels.com  Fri Mar  9 08:44:31 2007
From: jhannah at omnihotels.com (Jay Hannah)
Date: Fri, 9 Mar 2007 10:44:31 -0600
Subject: [Omaha.pm] Oldies but goodies!
In-Reply-To: <1173453751.9536.4.camel@sjedwards.omnihotels.com>
References: <1173453751.9536.4.camel@sjedwards.omnihotels.com>
Message-ID: <E59FF64509EEEA4C96BE4723AE9668536114C0@exchange2k3.omnihotels.net>


Not to mention:

Programmer Adam Back managed to squeeze the RSA algorithm into just two
lines of Perl:
http://world.std.com/~franl/crypto/rsa-guts.html

:)

j
 

-----Original Message-----
From: Sean J. Edwards 
Sent: Friday, March 09, 2007 9:23 AM
Subject: Oldies but goodies!

Perl "Too Good"

> Originally posted on www.perl.org in 1997: 

> 
>                           Perl "Too Good"
> 
> 
> This is a true story. Names have not been changed.
> 
> UCLA's Computer Science Undergraduate Association regularly hosts its
> programming competition.  Contestants are given six complex problems
> and have three hours to write programs to solve as many of the
problems
> as possible. In 1997, the rules stated that any programming language
> could be used so long as you solved the problem, so then-undergraduate
> Keith Chiem entered and used Perl.
> 
> Keith did not merely win, he conquered. He solved five of the six
> problems in the three hours allotted.  The second-place two-person
> team solved only three problems. They, needless to say, were not using
> Perl.
> 
> But if you're a UCLA undergraduate contemplating entering the contest
> and using Perl, don't bother. After Keith's conquest, Perl was banned
> from the contest.
> 
> You've got to admire a language that is banned because it makes
> problems too easy to solve.
> 
> These days, Keith is reportedly a sysadmin at Yahoo! Inc., and is
> wondering what to do with the copy of Visual C++ that was his prize.

Decode DVD's with 7 lines of PERL (from 2001):
http://www.wired.com/news/culture/0,1284,42259,00.html


From jay at jays.net  Mon Mar 12 17:52:43 2007
From: jay at jays.net (Jay Hannah)
Date: Mon, 12 Mar 2007 19:52:43 -0500
Subject: [Omaha.pm] Fwd: Friends Of Randall Schwartz...
References: <934f64a20703070910n2cd069deua5b28ea115ec65f9@mail.gmail.com>
Message-ID: <F087E58D-A8FA-4CF5-BFEC-1FAE53B71CD0@jays.net>

13 years later...

http://news.com.com/2102-7350_3-6164113.html?tag=st.util.print
Intel 'hacker' sentence expunged

j



From jhannah at omnihotels.com  Fri Mar 16 10:29:22 2007
From: jhannah at omnihotels.com (Jay Hannah)
Date: Fri, 16 Mar 2007 12:29:22 -0500
Subject: [Omaha.pm] pushing arrays onto arrays?
In-Reply-To: <E59FF64509EEEA4C96BE4723AE966853611810@exchange2k3.omnihotels.net>
References: <E59FF64509EEEA4C96BE4723AE966853611810@exchange2k3.omnihotels.net>
Message-ID: <E59FF64509EEEA4C96BE4723AE96685361192D@exchange2k3.omnihotels.net>

Nope. :)
 
What you expected would happen if you did "push @a, \@b".
 
j


________________________________
From: Sean Baker 
Sent: Thursday, March 15, 2007 8:51 AM
To: Programmers
Subject: pushing arrays onto arrays?

Wow.

I always thought that if you "push @a, @b", the @b would end up as some
type of reference in the @a array.  I guess not.

#!/usr/bin/perl

use strict;
# Push @b stuff onto @a separately.
#
my @a = qw(1 2 3);
my @b = qw(4 5 6);
foreach (@b) {
  push @a, $_;
}
 
print join " ", @a;
print "\n";

# push @b onto @a.
#
my @a = qw(1 2 3);
my @b = qw(4 5 6);
push @a, @b;
 
print join " ", @a;

exit; 

 


From jhannah at omnihotels.com  Tue Mar 20 14:55:46 2007
From: jhannah at omnihotels.com (Jay Hannah)
Date: Tue, 20 Mar 2007 16:55:46 -0500
Subject: [Omaha.pm] source code from 1992
Message-ID: <E59FF64509EEEA4C96BE4723AE966853611B72@exchange2k3.omnihotels.net>

Wow. Don't you love Perl? Below is Informix 4GL from 1992 I'm in today.

The perl version of the script below is:

   /^\d{7}$/

What's my code reduction ratio there?

:)

j



#########################
FUNCTION valid_iata(ptxt)
#########################

# This Function determines whether the string passed in (ptxt) is all
Numbers#

   DEFINE ptxt     char(8),
          tchar    char(1),
          i_flg    integer,
          i        integer

   LET i_flg = TRUE


   FOR i = 1 to 7
     LET tchar = ptxt[i,i]

     IF tchar is NULL THEN
        LET i_flg = FALSE
        EXIT FOR
     END IF

     IF tchar NOT MATCHES "[1234567890]" THEN
        LET i_flg = FALSE
        EXIT FOR
     END IF
   END FOR


   RETURN i_flg

END FUNCTION


From andy at petdance.com  Tue Mar 20 14:57:45 2007
From: andy at petdance.com (Andy Lester)
Date: Tue, 20 Mar 2007 16:57:45 -0500
Subject: [Omaha.pm] source code from 1992
In-Reply-To: <E59FF64509EEEA4C96BE4723AE966853611B72@exchange2k3.omnihotels.net>
References: <E59FF64509EEEA4C96BE4723AE966853611B72@exchange2k3.omnihotels.net>
Message-ID: <A1E4E984-449B-4615-9B30-80330EEC5681@petdance.com>


On Mar 20, 2007, at 4:55 PM, Jay Hannah wrote:

> The perl version of the script below is:
>
>    /^\d{7}$/
>
> What's my code reduction ratio there?

If you feel guilty, change it to

     /^\d\d\d\d\d\d\d$/

so it's longer.

--
Andy Lester => andy at petdance.com => www.petdance.com => AIM:petdance





From jay at jays.net  Tue Mar 27 02:47:38 2007
From: jay at jays.net (Jay Hannah)
Date: Tue, 27 Mar 2007 04:47:38 -0500
Subject: [Omaha.pm] Fwd: YAPC-NA CFP deadline approaching
References: <7f7c2d5e0703261342g96b2e5cj3f18b5228ea38d@mail.gmail.com>
Message-ID: <A25D351C-D637-48E2-A00D-EF2D8A55B12E@jays.net>

Ooo... Houston, June 25-27... I wonder if I can swing that?  Not sure  
what date I get back from Australia.  :)

j

--------
Two weeks remain in the Call For Participation!  Visit http:// 
conferences.mongueurs.net/yn2007 to register as a new user (or login  
with your existing account) and submit a talk proposal.  If possible,  
please indicate (in the comments section) if you consider this talk  
to be suitable for a beginner, intermediate, or advanced Perl user.   
Some of the comments from last year indicated a desire to know the  
level of knowledge expected of talk attendees.

Official CFP posting at http://conferences.mongueurs.net/yn2007/cfp.html

Jeremy Fluhmann
http://www.yapc.org/America


From jay at jays.net  Tue Mar 27 03:30:17 2007
From: jay at jays.net (Jay Hannah)
Date: Tue, 27 Mar 2007 05:30:17 -0500
Subject: [Omaha.pm] Fwd: brian d foy
References: <20070302182251.GA16257@panix.com>
Message-ID: <BEEFD864-201B-40E7-A54A-F7B33730FF4D@jays.net>


-laugh-

In case you have absolutely nothing better to do...   :)

j


Begin forwarded message:
> From: "David H. Adler" <dha at panix.com>
> Date: March 2, 2007 12:22:51 PM CST
>
> Our illustrious founder has wikipedia issues. As you may know, his
> preferred (and published) rendering of his name is 'brian d foy'.
> There's even a style guide.
>
> If you feel like it, you might forward those in your groups to
> http://en.wikipedia.org/wiki/Talk:Brian_D._Foy and join the fight to
> render him correctly on wikipedia.
>
> thanks,
>
> dha, unofficial sgt-at-arms
>
> -- 
> David H. Adler - <dha at panix.com> - http://www.panix.com/~dha/
> I'd redesign my program to something less absurd.
>     - Abigail, in comp.lang.perl.misc


From jay at jays.net  Tue Mar 27 04:39:14 2007
From: jay at jays.net (Jay Hannah)
Date: Tue, 27 Mar 2007 06:39:14 -0500
Subject: [Omaha.pm] Devel::Cover & BioPerl
Message-ID: <7AEEDFCC-EC50-42DF-8DD2-9EB267F7E3D1@jays.net>

Devel::Cover tells you statistics about whether or not your POD and  
tests are covering all of your source code.

Here's the results of Devel::Cover run against the BioPerl project:
http://bix.sendu.me.uk/bioperl_live_cover/coverage.html

Neat, huh? Anyone brave enough to run Devel::Cover against their own  
Perl and post the results to the list?  :)

About Devel::Cover:
http://search.cpan.org/dist/Devel-Cover/lib/Devel/Cover.pm
http://search.cpan.org/dist/Devel-Cover/lib/Devel/Cover/Tutorial.pod

j




From dan at linder.org  Tue Mar 27 06:19:30 2007
From: dan at linder.org (Daniel Linder)
Date: Tue, 27 Mar 2007 08:19:30 -0500 (CDT)
Subject: [Omaha.pm] Devel::Cover & BioPerl
In-Reply-To: <7AEEDFCC-EC50-42DF-8DD2-9EB267F7E3D1@jays.net>
References: <7AEEDFCC-EC50-42DF-8DD2-9EB267F7E3D1@jays.net>
Message-ID: <44199.68.13.153.38.1175001570.squirrel@www.linder.org>


On Tue, March 27, 2007 06:39, Jay Hannah wrote:
> Devel::Cover tells you statistics about whether or not your POD and
> tests are covering all of your source code.
...
> Neat, huh? Anyone brave enough to run Devel::Cover against their own
> Perl and post the results to the list?  :)

<humor>
Eh, so what is this concept of "POD" and "tests" you speak of?
</humor>

I think my code would cause the Devel::Cover module to run away screaming!

Dan

- - - -
"Wait for that wisest of all counselors, time." -- Pericles
"I do not fear computers, I fear the lack of them." -- Isaac Asimov


From KThompson at heiskell.com  Tue Mar 27 06:59:08 2007
From: KThompson at heiskell.com (Thompson, Kenn)
Date: Tue, 27 Mar 2007 06:59:08 -0700
Subject: [Omaha.pm] Devel::Cover & BioPerl
Message-ID: <16F8D15756891C4EA961565331A3B350066CE099@JDHEXC01.heiskell.com>

-->> <humor>
-->> Eh, so what is this concept of "POD" and "tests" you speak 
-->> of? </humor>
-->> 
-->> I think my code would cause the Devel::Cover module to run 
-->> away screaming!
-->> 

So would that make it Devel::duck_and_cover ?